Dinner Pie
40 recipes to browse.-
Wonderful Fiesta Pie
yummy- 7 comments
- 15 bookmarks
-
Runzas Aka Bierocks Or Krauts
sausagebeefcabbagecroissantitalianveggies- 12 comments
- 14 bookmarks
-
Creamy Chunky Chicken Pot Pies
chickenhomemadefuneasyvegetablesstockherbsflavorflak- 3 comments
- 10 bookmarks
-
by
Macaroni Ham Casserole
cheapeasyfillingkidfriendlysaltysavorycheesy- 3 comments
- 8 bookmarks
-
Tex-mex Brunch Casserole
makethisthenightbeforeandinviteeveryoneoverfornext- 2 comments
- 10 bookmarks
-
Spring Chicken Pot Pie
chickenpotpiecreamcheesecrustcreamyherbspeascarrots- 3 comments
- 8 bookmarks
-
Elaines Shepherds Pie With A Plus
easydeliciousbeef- 9 comments
- 7 bookmarks
-
Sweet N Spicy Gardeners Pie
sweetpotatoesspicyseasoningsveganvegetariantvpchickpea- 5 comments
- 10 bookmarks
-
Natchitoches Meat Pies
cajunmeatpiebeefporkvegetables- 5 comments
- 11 bookmarks
-
Terrifying Tamale Pie
cornpeppercheesepickleolivescarrots- 13 comments
- 9 bookmarks
-
by
Chicken Pot Pies
lengthyrecipebutverytastychickenmushroomsbeanspeas- 6 comments
- 7 bookmarks
-
Turkey Tamale Pot Pie
potpieturkeytamales- 3 comments
- 8 bookmarks
-
by
Pot Pie
good- 6 comments
- 7 bookmarks
-
Potato And Ham Torta
hampotatotortaspicyroastedvegetables- 2 comments
- 6 bookmarks
Narrow your search
Use the filters in this column to find the perfect recipe.
Types of Dinner Pies
Cuisine Filters
Ingredient Filters
meats
- ground beef 11
- bacon 4
- beef 4
- chicken 4
- ham 3
- pork 4
- sausage 4
- chicken breasts 1
- turkey 1
- ham steaks 1
- steaks 1
- View More ↓
- onion 31
- red bell peppers 13
- bell peppers 10
- green bell peppers 10
- carrots 7
- celery 5
- corn 5
- mushrooms 12
- tomatoes 18
- vegetables 4
- frozen peas 3
- broccoli 3
- cornbread 2
- fresh green beans 2
- frozen corn 2
- asparagus 1
- black-eyed peas 1
- cabbage 1
- chickpeas 1
- corn kernels 1
- corn muffin mix 1
- corn tortilla chips 1
- corn tortillas 1
- cornstarch 1
- eggplants 1
- spinach 1
- frozen whole kernel corn 1
- green peas 1
- heads of cabbage 1
- leeks 1
- peas and carrots 1
- peppercorns 1
- romaine lettuce 1
- sweet bell peppers 1
- sweet potatoes 1
- whole kernel corn 1
- zucchini 1
- View More ↓
- cheese 9
- cheddar cheese 7
- cream cheese 4
- mozzarella cheese 3
- parmesan cheese 2
- sharp cheddar cheese 2
- american cheese 1
- cheese sauce 1
- colby cheese 1
- goat cheese 1
- provolone cheese 1
- swiss cheese 1
- taco cheese 1
- View More ↓
- butter 9
- milk 8
- unsalted butter 6
- sour cream 3
- buttermilk 2
- heavy whipping cream 2
- skim milk 2
- whipped cream 2
- evaporated milk 1
- low-fat buttermilk 1
- low-fat milk 1
- margarine 1
- whipping cream 1
- whole milk 1
- View More ↓
- chilies 5
- chili powder 4
- adobo sauce 1
- cayenne 1
- chili beans 1
- chili sauce 1
- chipotle chiles in adobo 1
- jalapeno 1
- View More ↓
- eggs 19
- olives 7
- oil 6
- sugar 5
- black olives 4
- russet potatoes 4
- tomato paste 4
- pizza sauce 3
- baking powder 3
- bisquick 3
- chicken stock 3
- potatoes 2
- mashed potatoes 2
- yellow cornmeal 2
- pimientos 2
- macaroni 2
- canned tomato sauce 2
- baking mix 2
- hot water 2
- tomato sauce 1
- oat bran 1
- pasta sauce 1
- oats 1
- plums 1
- low sodium chicken broth 1
- hash browns 1
- green olives 1
- fryer 1
- pie shells 1
- frozen hash browns 1
- frozen pie crusts 1
- pinto beans 1
- raw potatoes 1
- roast 1
- rolls 1
- spaghetti 1
- stock 1
- textured vegetable protein 1
- tofu 1
- pie crusts 1
- tortillas 1
- turnips 1
- pickles 1
- cornmeal 1
- cooking spray 1
- double-acting baking powder 1
- cereal 1
- 9 inch pie shell 1
- aluminum foil 1
- baking soda 1
- beef stock 1
- biscuit mix 1
- biscuits 1
- broth 1
- canned black beans 1
- canned kidney beans 1
- colby 1
- self-rising cornmeal 1
- emeril's original essence 1
- cooked macaroni 1
- cooked spaghetti 1
- cooking oil 1
- cream of chicken soup 1
- croissants 1
- deep dish pie shells 1
- frozen hash brown potatoes 1
- egg wash 1
- elbow macaroni 1
- chicken broth 1
- yukon gold potatoes 1
- View More ↓
- garlic 13
- olive oil 15
- cloves 9
- pepper 35
- vegetable oil 4
- basil 4
- oregano 3
- seasoning 3
- cilantro 2
- cilantro leaves 2
- parsley 5
- ground cumin 2
- italian seasoning 2
- salt 3
- spices 2
- worcestershire sauce 2
- cumin 1
- dried oregano leaves 1
- dried tarragon 1
- ginger 1
- paprika 1
- ranch dressing 1
- red wine 1
- rosemary 1
- salsa 1
- salsa verde 1
- tarragon 1
- thyme 1
- white wine 1
- View More ↓






