Fry Onion Sauce
42 recipes to browse.-
Chicken Fried Rice With Sauce
chinesericefried rice- 2 comments
- 9 bookmarks
-
by
Bea Coles French Fried Onion Rings
easyspicy- 4 comments
- 10 bookmarks
-
by
French Fried Onion Cornbread
cornbreadfrenchfriedonionmeal- 7 comments
- 10 bookmarks
-
Leahs French Fried Onion Circles
easyquickonionsonionringszestysweet- 9 comments
- 5 bookmarks
-
by
Onion And Cheese Crusted French Fries
friesfrenchfriesbakedfrenchparmesancheesecheesyonions- 9 comments
- 7 bookmarks
-
by
Corn Souffle With Creamed Onion Sauce
easysidevegetablescornsouffleonioncreamybutterycorny- 2 comments
- 4 bookmarks
-
Ebi Fry With Sauce
shrimpebifrydelicious- 4 comments
- 5 bookmarks
-
by
French-fried Onion Rings
crispyandlightonion- 3 comments
- 7 bookmarks
-
by
Fried Onion Ranch Meatloaf
groundbeef- 2 comments
- 7 bookmarks
-
by
Fried Potatoes And Onions
cheapeasyquicktoprepareverytastypotatoesonionsseaso- 10 comments
- 5 bookmarks
-
Fried Califlower And Onion Rings
califlower- 0 comments
- 2 bookmarks
-
Fried Fish With Schezwan Sauce
easyspicywhite fishschezwan- 1 comments
- 7 bookmarks
-
Mom's Fried Egg With Tomato Sauce
eggssauceitaliangrated cheese- 8 comments
- 4 bookmarks
-
Fried Tortellini W Sauce
italian- 0 comments
- 2 bookmarks
Narrow your search
Use the filters in this column to find the perfect recipe.
Cuisine Filters
Ingredient Filters
meats
- bacon 4
- chicken 2
- ground beef 2
- oysters 2
- chicken breasts 1
- chicken flavor stuffing mix 1
- cod 1
- cooked ham 1
- crab 1
- pork 1
- halibut 1
- ham slices 1
- shrimp 2
- prawns 1
- red snapper 1
- salmon 1
- sausage 1
- trout 1
- veal stock 1
- View More ↓
- vegetables 9
- onion 23
- cornstarch 3
- red bell peppers 3
- carrots 2
- corn 2
- scallions 2
- tomatoes 4
- spinach 1
- black-eyed peas 1
- celery 1
- eggplants 1
- fresh corn kernels 1
- lettuce leaves 1
- romaine lettuce 1
- shallots 1
- sweet potatoes 1
- zucchini 1
- View More ↓
- cheese 4
- parmesan cheese 3
- camembert cheese 2
- cream cheese 2
- asiago cheese 1
- feta cheese 1
- fresh goat cheese 1
- goat cheese 1
- ricotta cheese 1
- romano cheese 1
- View More ↓
- butter 10
- milk 9
- buttermilk 3
- sour cream 3
- evaporated milk 1
- heavy cream 1
- heavy whipping cream 1
- unsalted butter 1
- whipped cream 1
- View More ↓
- chilies 4
- cayenne pepper 3
- hot sauce 3
- chili powder 2
- cayenne 1
- chili 1
- chili peppers 1
- chili sauce 1
- chipotle peppers 1
- hot chili peppers 1
- louisiana hot sauce 1
- red chili peppers 1
- red chilies 1
- View More ↓
- eggs 33
- bread 11
- oil 9
- baking powder 5
- peanut 4
- egg whites 4
- olives 4
- honey 3
- juice 3
- lemons 3
- pickles 3
- sugar 3
- lemon juice 2
- brown sugar 2
- cornmeal 2
- breadcrumbs 2
- paper 2
- panko 2
- potatoes 2
- yellow cornmeal 2
- lemons, juice of 2
- cracker crumbs 1
- cooking oil 1
- chicken stock 1
- chicken broth 1
- chicken bouillon cubes 1
- beer 1
- biscuits 1
- biscuit mix 1
- crisco 1
- baking potatoes 1
- baking mix 1
- arugula 1
- anchovy fillets 1
- cranberry sauce 1
- graham cracker crumbs 1
- egg yolks 1
- glaze 1
- italian bread 1
- ground turmeric 1
- gravy 1
- grand marnier 1
- graham crackers 1
- lemon zest 1
- garam masala powder 1
- lemon wedges 1
- chocolate 1
- frozen french fries 1
- fish sauce 1
- fish fillets 1
- fish 1
- extra firm tofu 1
- dark molasses 1
- southern comfort 1
- fryer 1
- raspberry preserves 1
- protein powder 1
- oyster sauce 1
- powdered sugar 1
- polenta 1
- pickle juice 1
- pecans 1
- pasta 1
- bittersweet chocolate 1
- masala 1
- marjoram 1
- marinara sauce 1
- maple syrup 1
- liqueur 1
- limes, zest of 1
- rabbit 1
- limes, juice of 1
- tea 1
- wonton wrappers 1
- white cornmeal 1
- turnips 1
- tortellini 1
- lime zest 1
- toast 1
- tartar sauce 1
- tomato sauce 1
- soft brown sugar 1
- sandwich bread 1
- rum 1
- roast 1
- red currant jelly 1
- red capsicums 1
- yoghurt 1
- View More ↓
- vegetable oil 10
- pepper 19
- cloves 5
- garlic 10
- seasoning 4
- basil 5
- canola oil 3
- cilantro 3
- herbs 3
- mayonnaise 3
- olive oil 3
- parsley 4
- capers 2
- dry white wine 2
- fresh herbs 2
- ground cumin 2
- horseradish 2
- salt 3
- oregano 2
- sesame oil 2
- sesame seeds 2
- chives 1
- cider vinegar 1
- cilantro leaves 1
- cooking wine 1
- coriander 1
- creole seasoning 1
- mustard 4
- dill 3
- ginger 1
- horseradish sauce 1
- hot paprika 1
- ketchup 1
- light soy sauce 1
- mirin 1
- mixed fresh herbs 1
- nutmeg 1
- old bay seasoning 1
- rice wine 1
- rosemary 1
- salad dressing 1
- soy sauce 1
- thyme 1
- wine 1
- View More ↓





