Cream Of Crab Soup
9 recipes to browse.-
Cream Of Spinach Soup
quickeasyhealthycreamyspinachveggies- 2 comments
- 11 bookmarks
-
by
Cream Of Spinach Soup
easyyummycreamyspinach- 7 comments
- 15 bookmarks
-
by
Cream Of Spinach Soup
easydeliciousspinachcarrotoniongarlicpotato- 6 comments
- 8 bookmarks
-
by
Cream Of Spinach And Artichoke Soup
easygourmetsoupcreamychickenspinachartichoke- 4 comments
- 6 bookmarks
-
Spring Pea Soup With Crab Flan
heartyeasy- 2 comments
- 4 bookmarks
-
Cream Of Ricotta And Vegetable Soup
potatoeslettucespinachleeksricottaoilparsleysaltpepp- 2 comments
- 3 bookmarks
-
Cream Of Spinach And Mushroom Soup
spinachportabellocomfort foodatkins friendly- 3 comments
- 6 bookmarks
-
by
Raw Vegan Cream Of Spinach Soup
rawveganstrong flavouredwinejuicercreamyspicysavoury- 0 comments
- 1 bookmarks
-
by
Cream Of Spinach Soup
easyspinachlow calorieshigh protein- 0 comments
- 1 bookmarks
Narrow your search
Use the filters in this column to find the perfect recipe.
Cuisine Filters
Ingredient Filters
meats
vegetables
- spinach 5
- leeks 2
- onion 4
- artichoke 2
- carrots 1
- celery 1
- green peas 1
- lettuce 1
- peas 1
- tomatoes 1
- View More ↓



