Quick Low Fat Waffles
41 recipes to browse.-
Healthy Shmealthy Lime Ina Coconut Muffins
healthy breakfastcoconutlimecitrusfastbreakfast- 3 comments
- 7 bookmarks
-
Easy, Healthy Quiche To Make Your Own
eggsbreakfastpievegetablesfrenchbrunchleftoversquick- 1 comments
- 1 bookmarks
-
Healthy Baked Meatballs
healthybakedburgers or meatballsquick- 2 comments
- 7 bookmarks
-
Healthy Shmealthy Banana Chocolate Muffins
healthybannanabreakfasteasyquicktasty- 0 comments
- 12 bookmarks
-
by
Healthy Chocolate, Coconut And Strawberry Milkshak...
easylow fathealthydeliciousquick- 0 comments
- 1 bookmarks
-
Healthy Milk Chocolate Chip Cookies
healthyideal brown substitutechocolate chipslow-fatlow-s- 0 comments
- 5 bookmarks
-
Healthy & Tasty Kale Stir Fry
healthytastyquick- 1 comments
- 7 bookmarks
-
Healthy Turkey Caesar Salad
caesar saladhealthyturkeylow fatsaladquick and easylef- 0 comments
- 3 bookmarks
-
Low Fat Easy Scrambled Eggs With Chicken
chickenlowfateasyquickavacadocilantroeggsbreakfastto- 1 comments
- 3 bookmarks
-
Low Fat White Chicken Chili
easyquicklowfatwhitechickenchilispicygarlickyhot- 1 comments
- 2 bookmarks
-
Easy Lowfat Cajun Jambalaya
lowfatquickeasychickenjambalayaseafoodpastaricespicy- 2 comments
- 4 bookmarks
-
by
Simple Healthy Stir Fry
easyquickhealthydeliciousasiansweetspiced- 4 comments
- 7 bookmarks
-
by
Low Fat Holiday Flans
easyquicklowfatflancustarddessertsweeteggycreamy- 2 comments
- 3 bookmarks
-
by
Best Healthy Dessert
easyfastsweetdelicioushealthy- 1 comments
- 3 bookmarks
Narrow your search
Use the filters in this column to find the perfect recipe.
Tag Filters
Ingredient Filters
meats
- chicken 4
- chicken breasts 4
- bay scallops 2
- red salmon 2
- skinless chicken 2
- anchovies 1
- bacon 1
- beef 1
- clams 1
- cooked chicken 1
- crawfish tails 1
- ground beef 1
- ham 1
- oysters 1
- shrimp 1
- salmon fillets 1
- sausage 1
- View More ↓
- onion 15
- vegetables 4
- red bell peppers 3
- broccoli 2
- cornstarch 2
- tomatoes 7
- mushrooms 4
- asparagus spears 1
- avocados 1
- spinach 3
- bean sprouts 1
- bell peppers 1
- cabbage 1
- carrots 1
- celery 1
- celery ribs 1
- collard greens 1
- corn 1
- corn tortillas 1
- green beans 1
- green bell peppers 1
- lettuce 1
- romaine lettuce 1
- scallions 1
- snow peas 1
- View More ↓
- raisins 3
- apple 5
- banana 2
- apricot 1
- coconut 2
- dried cherries 1
- frozen peaches 1
- peaches 1
- View More ↓
- cheese 3
- feta cheese 1
- italian cheese 1
- low-fat cream cheese 1
- parmesan cheese 1
- ricotta cheese 1
- romano cheese 1
- View More ↓
- skim milk 4
- milk 3
- butter 2
- dry milk 1
- evaporated skim milk 1
- i can't believe it's not butter 1
- light sour cream 1
- low-fat sour cream 1
- margarine 1
- nonfat dry milk powder 1
- peanut butter 1
- plain yogurt 1
- sour cream 1
- vanilla yogurt 1
- yogurt 1
- View More ↓
- olives 10
- eggs 7
- baking soda 5
- sugar 5
- flour 3
- brown sugar 3
- honey 3
- pasta 3
- oatmeal 2
- lime juice 2
- oil 2
- egg substitute 2
- potatoes 2
- chocolate 2
- dried fruit 2
- broth 2
- limes, juice of 2
- paper 1
- nuts 1
- penne 1
- oyster sauce 1
- oats 1
- oat bran 1
- almonds 1
- natural yoghurt 1
- macaroni 1
- lemons 1
- lemons, juice of 1
- limes 1
- vegetable broth 1
- rice 1
- penne pasta 1
- vegetable stock 1
- lemon peel 1
- rolled oats 1
- rolls 1
- small potatoes 1
- spaghetti 1
- splenda sugar substitute 1
- steel cut oats 1
- tortillas 1
- cocoa 1
- fish 1
- wheat bran 1
- wheat germ 1
- white beans 1
- whole wheat spaghetti 1
- xanthan gum 1
- protein powder 1
- fat free chicken broth 1
- lemon juice 1
- bran flakes 1
- walnuts 1
- basmati rice 1
- boiling water 1
- black olives 1
- black beans 1
- berries 1
- beans 1
- baking powder 1
- bamboo shoots 1
- almond extract 1
- whole wheat flour 1
- potato flour 1
- pastry flour 1
- chicken broth 1
- all-purpose flour 1
- bread 1
- juice 1
- chicken stock 1
- clam juice 1
- coleslaw mix 1
- egg noodles 1
- egg whites 1
- peanut 1
- fat-free chicken broth 1
- kaffir lime leaves 1
- fruit juice 1
- graham cracker squares 1
- graham crackers 1
- hard-boiled eggs 1
- hardboiled egg 1
- yoghurt 1
- View More ↓
- garlic 16
- cloves 11
- olive oil 10
- cilantro 3
- ginger 3
- salt 3
- vanilla 4
- basil 5
- canola oil 2
- cinnamon 2
- pepper 7
- nutmeg 2
- oregano 2
- soy sauce 2
- cajun seasoning 1
- capers 1
- coriander 1
- creole seasoning 1
- cumin 1
- curry powder 1
- dill 2
- dried rosemary 1
- parsley 1
- hoisin sauce 1
- italian salad dressing 1
- italian seasoning 1
- mint 1
- paprika 1
- red wine vinegar 1
- reduced sodium soy sauce 1
- rice wine vinegar 1
- seasoning 1
- sesame oil 1
- thyme 1
- toasted sesame seeds 1
- vegetable oil 1
- vinegar 1
- white vinegar 1
- white wine 1
- white wine vinegar 1
- View More ↓






