Salmon Soy Sauce Recipes
48 recipes to browse.-
Babi Chin - Pork Braised In Dark Soy Sauce
porkcoriandershallotsgarliccinnamonsoybeansauceorhois- 10 comments
- 9 bookmarks
-
by
Salmon Steaks With Soy-maple Glaze
salmonmaplesyrupsoysaucesoysauce- 2 comments
- 8 bookmarks
-
by
Soy Joy Sauce
sidecondimentsaucesoygingercloveseasyelegantmarinade- 3 comments
- 11 bookmarks
-
Fried Fish Braised In Soy Sauce And Chilli Oil
fishwithsoysauceandchillioilgarlickyhotspicy- 3 comments
- 6 bookmarks
-
Pasta With Clams And Soy Sauce
colorfulsavorylightsoyfishy- 1 comments
- 5 bookmarks
-
Poached Pork With Garlic And Soy Sauce
poachedporkgarlicsoysaucegarlicky- 0 comments
- 4 bookmarks
-
by
Balinese Beef Satay With Sweet Soy Sauce
asianindonesianbalisataybeef- 5 comments
- 4 bookmarks
-
Crisp Cod With Soy-ginger Dipping Sauce
fishgingergingery- 3 comments
- 4 bookmarks
-
Pan Fried Tofu With Yoghurt Sauce And Soy Puffs
tofufriedgarammasalavegetariancrsipycoatedsoftcenter- 1 comments
- 2 bookmarks
-
Sausage And Spinach In Sweet Soy Sauce
sausagespinachsweet- 2 comments
- 4 bookmarks
-
by
Seared Salmon With Soy Sauce And Garlic
salmongarlictamarisoysaucecorianderherbs- 2 comments
- 4 bookmarks
-
by
Pork With Ginger In Dark Soy Sauce
porkchickengingersalty- 3 comments
- 3 bookmarks
-
Soy Sauce Chicken
chicken- 1 comments
- 5 bookmarks
-
by
Pineapple-soy Glazed Salmon
canned- 1 comments
- 1 bookmarks
Narrow your search
Use the filters in this column to find the perfect recipe.
Cuisine Filters
Ingredient Filters
meats
- salmon fillets 8
- salmon 6
- pork 6
- smoked salmon 3
- canned salmon 2
- chicken 2
- salmon steaks 2
- steaks 2
- bacon 1
- beef 1
- beef steaks 1
- chicken thighs 1
- clams 1
- cod 1
- crab 1
- ham slices 1
- oysters 1
- pink salmon 1
- sausage 2
- whole chickens 1
- View More ↓
- onion 18
- scallions 6
- shallots 5
- tomatoes 8
- cornstarch 3
- vegetables 3
- carrots 2
- lettuce 2
- peppercorns 2
- avocados 1
- bibb lettuce 1
- celery 1
- corn 1
- cucumbers 1
- english cucumbers 1
- fresh asparagus 1
- spinach 1
- green beans 1
- leaf lettuce 1
- lettuce leaves 1
- red bell peppers 1
- romaine lettuce leaves 1
- mushrooms 1
- yellow bell peppers 1
- zucchini 1
- View More ↓
- chilies 3
- chili sauce 2
- cayenne pepper 1
- chili 1
- chili flakes 1
- chili peppers 1
- heinz chili sauce 1
- hot red chili peppers 1
- red chili peppers 1
- red chilies 1
- sweet chili sauce 1
- View More ↓
- olives 12
- lemons, juice of 7
- oil 6
- eggs 6
- flour 6
- sugar 6
- lemons 5
- lemon juice 5
- beans 4
- honey 4
- peanut 4
- brown sugar 4
- toast 3
- molasses 2
- cooking oil 2
- fish 2
- limes, juice of 2
- black olives 2
- noodles 2
- roast 2
- pasta 2
- tomato paste 2
- tamari 2
- parmesan cheese 2
- bamboo skewers 1
- bamboo shoots 1
- chicken stock 1
- chicken broth 1
- cheddar cheese 1
- angel hair pasta 1
- catsup 1
- crackers 1
- condensed cream of chicken soup 1
- dark brown sugar 1
- biscuits 1
- crepes 1
- biscuit mix 1
- fresh lemon juice 1
- duck 1
- egg whites 1
- extra firm tofu 1
- lime zest 1
- dry vermouth 1
- farfalle pasta 1
- garam masala powder 1
- glaze 1
- gluten 1
- lemon wedges 1
- lemons, rind of 1
- light soya sauce 1
- lime juice 1
- fish stock 1
- vermouth 1
- panko 1
- oyster sauce 1
- miso 1
- masala 1
- skewers 1
- pine nuts 1
- limes, zest of 1
- potatoes 1
- all-purpose flour 1
- pistachios 1
- pure maple syrup 1
- protein powder 1
- red thai chile 1
- rice 1
- wonton wrappers 1
- soya sauce 1
- spaghetti 1
- squid 1
- star anise 1
- stock 1
- tamarind juice 1
- tomato sauce 1
- limes 1
- water chestnuts 1
- unsulphured molasses 1
- soft breadcrumbs 1
- yoghurt 1
- pistachio nuts 1
- View More ↓
- cloves 28
- garlic 35
- soy sauce 17
- ginger 14
- olive oil 11
- sesame oil 9
- pepper 18
- rice vinegar 4
- cilantro 3
- rice wine 3
- sesame seeds 3
- vegetable oil 3
- canola oil 2
- capers 2
- cinnamon sticks 2
- dark sesame oil 2
- dark soy sauce 2
- dry white wine 2
- parsley 6
- toasted sesame oil 2
- vinegar 2
- white wine 2
- balsamic vinegar 1
- bay leaves 1
- black sesame seeds 1
- chives 1
- cinnamon 1
- salt 2
- coriander 1
- coriander seeds 1
- mustard 6
- creole seasoning 1
- dill 3
- dry sherry 1
- five-spice powder 1
- basil 2
- fresh coriander 1
- herbs 1
- hoisin sauce 1
- mayonnaise 2
- light soy sauce 1
- low sodium soy sauce 1
- marinade 1
- nutmeg 1
- old bay seasoning 1
- oregano 1
- red wine 1
- reduced sodium soy sauce 1
- sage leaves 1
- spices 1
- toasted sesame seeds 1
- white sesame seeds 1
- white vinegar 1
- white wine vinegar 1
- wine 1
- View More ↓