Easy Low Fat Spinach
35 recipes to browse.- 
        	
        	
        	        	
        	
        	        	
        	
        		
        		
	            Low-fat Vegan Coffee Cakewholegrainmoistcoffeecakeveganyeastfreevegetarianeggfr- 2 comments
- 41 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Deleted- 10 comments
- 31 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		
        		
	            Healthy Baked Salmonbeautifulbakedsalmoneasyandquickjuicylemonymeltiny- 3 comments
- 32 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Healthy Curry Sauceeasycheapquickhottastytomatoey- 3 comments
- 15 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Lowfat Cajun Crawfish Pastaeasyquickdeliciousseafoodspicygarlickyhot- 6 comments
- 7 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Mums Ricotta Low Fat Creameasyquicklowfatcreamsubstitutecreamysweet- 0 comments
- 4 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Best Healthy Desserteasyfastsweetdelicioushealthy- 1 comments
- 3 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Low Fat Holiday Flanseasyquicklowfatflancustarddessertsweeteggycreamy- 2 comments
- 3 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Microwave Low-fat Granolaeasyquicksweet- 3 comments
- 6 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		
        		
	            Very Low-fat Seasoned Croutonscroutonslowfateasyfastquicksimpledeliciouscrunchyexp- 1 comments
- 6 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		
        		
	            Low Fat Chicken Corn Chowderheartyeasyfasthealthycornchickenrichflavorful- 4 comments
- 1 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		
        		
	            Low Fat White Chicken Chilieasyquicklowfatwhitechickenchilispicygarlickyhot- 1 comments
- 2 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		
        		
	            Low-fat Tomatoes Dipquickeasytastefulspicytastyvegetably- 0 comments
- 1 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		
        		
	            Low Fat Black Bean Soupeasyfastlowfatoniongarlicspiceycreamy- 0 comments
- 3 bookmarks
 
Narrow your search
                		Use the filters in this column to find the perfect recipe. 
                	
                	
                	
                	                	
                	 
                	
                	                	Tag Filters 
                		
                		
                	Ingredient Filters 
                		
                		
                		                		meats
                		- chicken 4
- chicken breasts 4
- bay scallops 2
- red salmon 2
- anchovies 1
- bacon 1
- beef 1
- clams 1
- cooked chicken 1
- crawfish tails 1
- ground beef 1
- ham 1
- oysters 1
- shrimp 1
- salmon fillets 1
- sausage 1
- skinless chicken 1
- View More ↓
- onion 14
- vegetables 4
- red bell peppers 3
- broccoli 2
- cornstarch 2
- tomatoes 7
- mushrooms 4
- spinach 3
- bean sprouts 1
- bell peppers 1
- cabbage 1
- carrots 1
- celery 1
- celery ribs 1
- collard greens 1
- corn 1
- green beans 1
- green bell peppers 1
- lettuce 1
- romaine lettuce 1
- scallions 1
- snow peas 1
- View More ↓
- cheese 3
- feta cheese 1
- italian cheese 1
- low-fat cream cheese 1
- ricotta cheese 1
- romano cheese 1
- View More ↓
- skim milk 4
- milk 3
- butter 2
- dry milk 1
- evaporated skim milk 1
- i can't believe it's not butter 1
- low-fat sour cream 1
- margarine 1
- nonfat dry milk powder 1
- plain yogurt 1
- sour cream 1
- yogurt 1
- View More ↓
- olives 9
- eggs 6
- baking soda 4
- sugar 4
- brown sugar 3
- egg substitute 2
- potatoes 2
- broth 2
- dried fruit 2
- pasta 2
- honey 2
- chocolate 2
- all-purpose flour 1
- macaroni 1
- natural yoghurt 1
- protein powder 1
- nuts 1
- oat bran 1
- almonds 1
- oats 1
- oil 1
- oyster sauce 1
- paper 1
- oatmeal 1
- vegetable broth 1
- limes, juice of 1
- tortillas 1
- xanthan gum 1
- rice 1
- rolled oats 1
- small potatoes 1
- spaghetti 1
- splenda sugar substitute 1
- lime juice 1
- lemons, juice of 1
- vegetable stock 1
- cocoa 1
- wheat germ 1
- white beans 1
- whole wheat spaghetti 1
- penne pasta 1
- hard-boiled eggs 1
- wheat bran 1
- black olives 1
- bran flakes 1
- boiling water 1
- pastry flour 1
- potato flour 1
- whole wheat flour 1
- almond extract 1
- baking powder 1
- bamboo shoots 1
- basmati rice 1
- beans 1
- berries 1
- black beans 1
- egg noodles 1
- lemons 1
- lemon peel 1
- bread 1
- chicken broth 1
- chicken stock 1
- clam juice 1
- hardboiled egg 1
- egg whites 1
- fruit juice 1
- walnuts 1
- flour 1
- juice 1
- kaffir lime leaves 1
- lemon juice 1
- yoghurt 1
- View More ↓
- garlic 15
- cloves 9
- olive oil 9
- ginger 3
- basil 5
- canola oil 2
- cilantro 2
- cinnamon 2
- pepper 7
- nutmeg 2
- salt 2
- soy sauce 2
- vanilla 3
- cajun seasoning 1
- capers 1
- coriander 1
- creole seasoning 1
- curry powder 1
- dill 2
- hoisin sauce 1
- italian salad dressing 1
- italian seasoning 1
- mint 1
- oregano 1
- paprika 1
- reduced sodium soy sauce 1
- rice wine vinegar 1
- seasoning 1
- sesame oil 1
- thyme 1
- toasted sesame seeds 1
- vegetable oil 1
- vinegar 1
- white vinegar 1
- white wine vinegar 1
- View More ↓




