Fry Shrimp Sauce
43 recipes to browse.- 
        	
        	
        	        	
        	
        	        	
        	
        		by Deep Fried Shrimp Stuffed With Crabmexicaneasyawesomesweetcrabshrimpbacon- 7 comments
- 13 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Shrimp And Mango With Herb Sauceshrimpmangocreamygrilledquickeasyelegantsavorysweet- 3 comments
- 15 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Dads Insanity Sauce Shrimpquickshrimpbroilbutteryhoteasyincendiaryspicygarlic- 3 comments
- 12 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		
        		
	            Shrimp In White Saucemexicanromantichighlycaloricbutyummy- 6 comments
- 16 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Garlic Shrimp Stir-fryeasygarlic- 4 comments
- 9 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		
        		
	            Remoulade Sauced Shrimp Saladshrimpsaladremouladesaucetangycreamyseafood- 3 comments
- 4 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		
        		
	            Chicken In Shrimp Sauceshrimpandchickenwhowouldhavethoughtwine- 3 comments
- 3 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Shrimp In Dill Saucemainfishshellfishshrimpmustardlemonvinegardillshrimp- 1 comments
- 3 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Shrimp With Curry And Peanut Saucemainfishshrimpcurrypeanutnutssavoryzestyherbysaucy- 1 comments
- 3 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Spaghetti With Shrimp In Garlic Sauceeasymainpastaspaghettifishshellfishshrimpgarlicsavor- 1 comments
- 1 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Fried Potato Patties With Dry Shrimppotatoesshrimppeppers- 2 comments
- 2 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		
        		
	            Shrimp With Green Sauceoilgarlicbrandywhitewineparsleysaltpeppershrimpbaguettesea- 6 comments
- 1 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Haddock Fillets With Shrimp Saucefishsaucehaddockfilletsshrimpsaucemicrowavegood- 1 comments
- 2 bookmarks
 
- 
        	
        	
        	        	
        	
        	        	
        	
        		by Shrimp Friedshrimpfried- 0 comments
- 1 bookmarks
 
Narrow your search
Cuisine Filters 
                		
                		
                	Ingredient Filters 
                		
                		
                		                		meats
                		- shrimp 31
- scallops 2
- anchovies 1
- bacon 1
- bay scallops 1
- crab 2
- halibut fillets 1
- salmon steaks 1
- sea scallops 1
- steaks 1
- View More ↓
- vegetables 8
- onion 11
- tomatoes 9
- corn 2
- spinach 2
- red bell peppers 2
- scallions 2
- shallots 2
- bell peppers 1
- carrots 1
- celery 1
- mushrooms 1
- fresh snow peas 1
- frozen peas 1
- lettuce 1
- zucchini 1
- View More ↓
- butter 12
- margarine 6
- unsalted butter 4
- whipping cream 3
- milk 2
- sour cream 2
- buttermilk 1
- coconut milk 1
- creamy peanut butter 1
- heavy cream 1
- heavy whipping cream 1
- salted butter 1
- whipped cream 1
- View More ↓
- chilies 2
- hot sauce 2
- jalapeno 3
- adobo sauce 1
- cayenne 1
- cayenne pepper 1
- chili 1
- chili oil 1
- dried red chilies 1
- green chilies 1
- red chili peppers 1
- View More ↓
- olives 16
- eggs 8
- lemon juice 6
- bread 6
- pasta 6
- oil 6
- lemons, juice of 6
- limes, juice of 5
- lemons 4
- peanut 3
- lime juice 3
- tomato paste 3
- juice 3
- sugar 3
- flour 2
- almonds 2
- egg yolks 2
- white rice 2
- beer 2
- all-purpose flour 2
- rice noodles 2
- lime zest 2
- brandy 2
- cake 2
- limes, zest of 2
- new potatoes 2
- spaghetti 2
- roast 2
- linguine 2
- rice flour 2
- parmesan cheese 2
- limes 2
- penne pasta 2
- potatoes 2
- panko 1
- romano cheese 1
- ricotta cheese 1
- cream cheese 1
- mozzarella cheese 1
- fresh goat cheese 1
- baguette 1
- chicken broth 1
- cooked white rice 1
- boiling water 1
- breadcrumbs 1
- canned tomato sauce 1
- broth 1
- cognac 1
- angel hair pasta 1
- emeril's original essence 1
- fish fillets 1
- cooked brown rice 1
- turmeric 1
- ground mace 1
- lemon wedges 1
- garam masala powder 1
- marinara sauce 1
- masala 1
- protein powder 1
- rice 1
- feta cheese 1
- extra firm tofu 1
- tomato sauce 1
- tortellini 1
- vegetable broth 1
- watercress leaves 1
- toast 1
- white flour 1
- yoghurt 1
- View More ↓
- parsley 41
- olive oil 26
- garlic 28
- cloves 15
- pepper 21
- vegetable oil 7
- dry white wine 5
- paprika 5
- capers 4
- cilantro 4
- mayonnaise 4
- old bay seasoning 4
- white wine vinegar 4
- mustard 4
- ginger 3
- salt 5
- oregano 3
- red wine vinegar 3
- cooking sherry 2
- creole seasoning 2
- basil 6
- herbs 2
- tarragon 2
- vinegar 2
- chives 1
- dill 1
- fresh mint leaves 1
- fresh thyme leaves 1
- ground coriander 1
- ground cumin 1
- horseradish 1
- minced ginger 1
- nutmeg 1
- port wine 1
- rice vinegar 1
- rose wine 1
- salad dressing 1
- sesame oil 1
- soy sauce 1
- tabasco sauce 1
- thyme 1
- white wine 1
- wine vinegar 1
- worcestershire sauce 1
- View More ↓



