Sandwiches
49 recipes to browse.-
Banh Mi
vietnamesesandwichchickenspicyfresh- 15 comments
- 60 bookmarks
-
Vietnamese Steak Sandwich
vietnamesesteaksandwichesfresheasypeppercarrots- 3 comments
- 21 bookmarks
-
Korean Sloppy Joes
koreanfusionporkgroundbeefzestyspicygarlicypepper- 5 comments
- 20 bookmarks
-
by
Chinese Chicken Salad
healthylightasian- 3 comments
- 16 bookmarks
-
Mexican Chicken And Rice Wraps
easyspicymexican- 3 comments
- 14 bookmarks
-
by
Hoisin Chicken Wraps
chickengarliccarrotsscallionshoisinsauceasiantasty- 12 comments
- 12 bookmarks
-
Thai Red Chicken Panini
paninis- 2 comments
- 10 bookmarks
-
by
Jambalaya Wrap
cajunsausagehamshrimp- 4 comments
- 11 bookmarks
-
by
Asian Chicken Wraps
asianchickenwrappeanuts-sesameoil- 3 comments
- 8 bookmarks
-
by
Falafel Sandwiches
whatsforlunchexotic- 3 comments
- 9 bookmarks
-
Wasabi Infused Mahi Mahi Sandwiches With Napa Slaw
heathygrilledsandwichjapaneseswordfishwasabicabbagegi- 6 comments
- 7 bookmarks
-
by
Fruity Chicken Salad
maindishsaladcreamyfruitychicken- 4 comments
- 6 bookmarks
-
by
Chicken Ramen Noodle Salad
easycheaphealthyorangeasianinspired- 1 comments
- 7 bookmarks
-
by
Asian Peanut Chicken With Cucumber Salad
chickencucumbermintpeanutsaucemixchickenoilasianpeanutty- 1 comments
- 7 bookmarks
Narrow your search
Use the filters in this column to find the perfect recipe.
Types of Sandwiches
Cuisine Filters
Ingredient Filters
meats
- chicken breasts 12
- chicken 5
- steaks 4
- tuna 4
- cooked chicken 2
- beef 1
- boneless chicken thighs 1
- chicken pieces 1
- cooked chicken breasts 1
- shrimp 3
- flank steaks 1
- ground beef 2
- pork 1
- turkey 2
- ham 1
- mahi mahi fillets 1
- oysters 1
- rib eye steaks 1
- skinless boneless chicken breast halves 1
- skinless chicken 1
- sausage 1
- steak 1
- tuna steaks 1
- View More ↓
- carrots 10
- onion 24
- tomatoes 7
- vegetables 6
- cucumbers 5
- lettuce 5
- celery 4
- scallions 4
- shallots 4
- red bell peppers 3
- avocados 2
- bean sprouts 2
- lettuce leaves 2
- mushrooms 4
- napa cabbage 2
- zucchini 2
- baby carrots 1
- spinach 4
- bell peppers 1
- butter lettuce 1
- corn 1
- corn oil 1
- corn syrup 1
- eggplants 1
- english cucumbers 1
- frozen corn 1
- green bell peppers 1
- artichoke 1
- peas 1
- red beets 1
- red cabbage 1
- romaine lettuce 1
- seedless cucumber 1
- View More ↓
- cheese 3
- cheddar cheese 2
- cream cheese 1
- feta 1
- manchego cheese 1
- monterey jack cheese 1
- swiss cheese 1
- View More ↓
- sour cream 4
- peanut butter 3
- butter 2
- coconut milk 2
- plain yogurt 2
- chunky peanut butter 1
- fat free sour cream 1
- View More ↓
- chilies 4
- chili powder 3
- jalapeno 4
- cayenne pepper 2
- chili sauce 2
- hot sauce 2
- picante sauce 2
- adobo sauce 1
- cayenne 1
- red chili sauce 1
- red chilies 1
- sweet chili sauce 1
- wasabi paste 1
- View More ↓
- rice 11
- oil 8
- olives 7
- sugar 7
- flour tortillas 6
- limes, juice of 5
- lemons, juice of 4
- beans 4
- lemon juice 4
- limes 4
- toast 4
- lime juice 3
- cooked rice 3
- roast 3
- bread 3
- rolls 3
- tamari 3
- fish sauce 2
- 10-inch flour tortillas 2
- baguette 2
- brown rice 2
- cooked brown rice 2
- pea pods 2
- light brown sugar 2
- pita breads 2
- white rice 2
- tomato paste 2
- watercress 2
- rice noodles 2
- pita bread 2
- tahini 2
- cashew nuts 1
- condensed cream of chicken soup 1
- ciabatta 1
- chicken stock 1
- chicken broth 1
- brown sugar 1
- canned black beans 1
- cake 1
- brown lentils 1
- boiling water 1
- black olives 1
- black beans 1
- cream of chicken soup 1
- eggs 1
- lime peel 1
- egg whites 1
- enchilada sauce 1
- extra firm tofu 1
- french baguettes 1
- ground round 1
- hamburger buns 1
- hard-boiled eggs 1
- honey 1
- hot water 1
- hummus 1
- jasmine rice 1
- kaffir lime leaves 1
- linguine 1
- cooked white rice 1
- salad greens 1
- couscous 1
- ripe olives 1
- pine nuts 1
- ramen noodles 1
- potatoes 1
- pita pockets 1
- pinto beans 1
- palm sugar 1
- pecans 1
- pasta 1
- panko 1
- nutritional yeast 1
- minute rice 1
- maple syrup 1
- flour 1
- long grain rice 1
- salad oil 1
- sesame seed oil 1
- sliced water chestnuts 1
- sourdough bread 1
- spaghetti 1
- sunflower seeds 1
- textured vegetable protein 1
- tomato puree 1
- tortillas 1
- vinaigrette 1
- whole grain bread 1
- whole wheat hamburger buns 1
- liquid smoke flavoring 1
- whole wheat tortillas 1
- View More ↓
- garlic 17
- cloves 11
- rice vinegar 11
- cilantro 9
- ginger 9
- soy sauce 9
- mayonnaise 11
- olive oil 10
- rice wine vinegar 7
- pepper 24
- marinade 4
- parsley 5
- taco seasoning 4
- vegetable oil 4
- vinegar 4
- mint 3
- oregano 3
- salsa 3
- seasoned rice vinegar 3
- sesame oil 3
- basil 3
- cider vinegar 2
- cilantro leaves 2
- cumin 2
- curry powder 2
- mustard 4
- hoisin sauce 2
- minced ginger 2
- seasoning 2
- thyme 2
- toasted sesame oil 2
- worcestershire sauce 2
- barbecue sauce 1
- black vinegar 1
- cajun seasoning 1
- chives 1
- chunky salsa 1
- cooking wine 1
- coriander 1
- dry red wine 1
- fresh cilantro leaves 1
- ground cumin 1
- herbs 1
- salt 1
- light soy sauce 1
- mirin 1
- ranch dressing 1
- reduced sodium soy sauce 1
- salad dressing 1
- sesame seeds 1
- spices 1
- steak sauce 1
- thai red curry paste 1
- white vinegar 1
- white wine vinegar 1
- View More ↓




