Fry Tofu Burgers
47 recipes to browse.-
Baby Bella Tofu Stir-fry With Oyster Sauce
tofubaby bella mushroomsbroccolioyster saucesoy saucesu- 4 comments
- 10 bookmarks
-
Masala-tofu Burger
vegetarianveganveggie burgerindianlunchdinnersandwich- 1 comments
- 7 bookmarks
-
Stir-fried Tofu And Bok Choy
vegetable side dishtofu and bok choy stir-fry- 1 comments
- 4 bookmarks
-
by
Peanut Butter Tofu Stir Fry With Noodles
stirfry noodleschinesejapanese- 1 comments
- 2 bookmarks
-
Pan Fried Tofu With Sautéed Mushrooms And Chimich...
tofuvegetarianvegetablessoy- 2 comments
- 13 bookmarks
-
Tofu Veggie And Almond Stir Fry
tofualmondsicy- 1 comments
- 3 bookmarks
-
by
Tofu Stir Fry
chinesecheapeasyhealthyvegetariansavoryoriental- 1 comments
- 2 bookmarks
-
Pan Fried Tofu With Yoghurt Sauce And Soy Puffs
tofufriedgarammasalavegetariancrsipycoatedsoftcenter- 1 comments
- 2 bookmarks
-
Tofu And Baby Corns Stir Fry
chinesetofugarlicky- 1 comments
- 2 bookmarks
-
Easy And Tasty Tofu Stir Fry
asianstirfrytofugarliconionspepperscarrotsgingermus- 2 comments
- 4 bookmarks
-
Fried Rice With Scallions Edamame And Tofu
friedricesavory- 0 comments
- 1 bookmarks
-
Fried Tofu With Stir Fried Vegetables
friedtofuorientalvegetarianvegetablescrispysoftbrocol- 1 comments
- 12 bookmarks
-
by
Deep-fried Tofu With Dipping Sauce
garlictofuchileoilsoysaucevinegarsugaronionspicytan- 3 comments
- 8 bookmarks
-
Stir Fried Pork With Tofu In Oyster Sauce
orientalstirfriedfilipinoginilingchinesejuicysalty- 3 comments
- 6 bookmarks
Narrow your search
Use the filters in this column to find the perfect recipe.
Cuisine Filters
Ingredient Filters
meats
- oysters 5
- ground beef 3
- bacon 1
- beef tenderloin 1
- tuna 1
- chicken 1
- ground chicken 1
- pork 1
- hamburger 1
- salmon fillets 1
- steak 1
- steaks 1
- turkey 1
- View More ↓
- onion 25
- carrots 12
- vegetables 10
- bean sprouts 3
- bok choy 3
- cabbage 3
- mushrooms 9
- red bell peppers 3
- scallions 3
- snow peas 3
- tomatoes 3
- baby corn 2
- cornstarch 2
- alfalfa sprouts 1
- avocados 1
- baby carrots 1
- broccoli 2
- cauliflower 1
- cauliflower florets 1
- celery 1
- corn 1
- cornflake crumbs 1
- cornflour 1
- cucumbers 1
- fresh bean sprouts 1
- frozen green beans 1
- frozen peas 1
- frozen peas and carrots 1
- green bell peppers 1
- green cabbage 1
- lettuce 1
- mung bean sprouts 1
- shallots 1
- spinach 1
- sweet potatoes 1
- View More ↓
- milk 3
- butter 1
- creamy peanut butter 1
- margarine 1
- peanut butter 1
- unsweetened coconut milk 1
- View More ↓
- chili sauce 3
- chilies 3
- chili paste 2
- sweet chili sauce 2
- cayenne pepper 1
- cayenne powder 1
- chili oil 1
- hot sauce 1
- red chili sauce 1
- red chilies 1
- View More ↓
- firm tofu 17
- oil 15
- eggs 13
- tofu 12
- sugar 9
- flour 6
- extra firm tofu 6
- oyster sauce 5
- olives 4
- fish sauce 3
- lime juice 3
- rolls 3
- buns 3
- bread 3
- limes, juice of 3
- cheddar cheese 2
- stir-fry sauce 2
- toast 2
- sesame seed oil 2
- swiss cheese 2
- honey 2
- beans 2
- cooked brown rice 2
- roast 2
- cooking oil 2
- cooked rice 2
- noodles 2
- sambal oelek 1
- lemons, juice of 1
- lemons, zest of 1
- long grain white rice 1
- masala 1
- mung beans 1
- panko 1
- pickles 1
- protein powder 1
- wooden skewers 1
- semisweet chocolate 1
- lemon zest 1
- shoyu 1
- silken tofu 1
- string beans 1
- tamari 1
- tea 1
- vegetable stock 1
- water chestnuts 1
- white beans 1
- instant rice 1
- chips 1
- shiitake mushroom caps 1
- brown sugar 1
- quick-cooking oats 1
- cornmeal 1
- cooked jasmine rice 1
- cheese 1
- cream cheese 1
- baking potatoes 1
- bamboo shoots 1
- beer 1
- black bean sauce 1
- black beans 1
- black tea 1
- hamburger buns 1
- cake 1
- edamame 1
- egg noodles 1
- egg substitute 1
- egg whites 1
- espresso powder 1
- fish 1
- garam masala powder 1
- ground venison 1
- hot water 1
- yoghurt 1
- View More ↓
- cloves 14
- garlic 17
- ginger 13
- soy sauce 12
- vegetable oil 9
- sesame seeds 4
- pepper 16
- canola oil 3
- cilantro 3
- ketchup 3
- low sodium soy sauce 3
- olive oil 3
- hoisin sauce 2
- seasoning 2
- sesame oil 2
- capers 1
- chinese five spice powder 1
- chinese rice wine 1
- cinnamon 1
- salt 6
- coriander 1
- dark sesame oil 1
- dark soy sauce 1
- dill 1
- basil 1
- dry sherry 1
- ground cumin 1
- ground ginger 1
- light soy sauce 1
- marinade 1
- mayonnaise 1
- minced ginger 1
- mint 1
- mirin 1
- mustard 2
- oriental sesame oil 1
- parsley 1
- rice vinegar 1
- rice wine vinegar 1
- salad dressing 1
- spices 1
- teriyaki sauce 1
- thyme 1
- toasted sesame oil 1
- vinegar 1
- white vinegar 1
- worcestershire sauce 1
- View More ↓









