Quick, Fry Tofu
49 recipes to browse.-
Baby Bella Tofu Stir-fry With Oyster Sauce
tofubaby bella mushroomsbroccolioyster saucesoy saucesu- 4 comments
- 10 bookmarks
-
Sandy's Quick Potato And Hot Dog Fry @copyright
potato'sonionhot dogsvegetable oil- 3 comments
- 1 bookmarks
-
Fast Veggie Stir-fry
quickeasydeliciousveggies- 0 comments
- 1 bookmarks
-
Stir-fried Tofu And Bok Choy
vegetable side dishtofu and bok choy stir-fry- 1 comments
- 4 bookmarks
-
by
Peanut Butter Tofu Stir Fry With Noodles
stirfry noodleschinesejapanese- 1 comments
- 2 bookmarks
-
Pan Fried Tofu With Sautéed Mushrooms And Chimich...
tofuvegetarianvegetablessoy- 2 comments
- 13 bookmarks
-
by
Quick Pile Up Burritos-n-fries
burritosfrenchfriescheesetomatoes- 5 comments
- 2 bookmarks
-
Tofu Veggie And Almond Stir Fry
tofualmondsicy- 1 comments
- 3 bookmarks
-
by
Tofu Stir Fry
chinesecheapeasyhealthyvegetariansavoryoriental- 1 comments
- 2 bookmarks
-
Pan Fried Tofu With Yoghurt Sauce And Soy Puffs
tofufriedgarammasalavegetariancrsipycoatedsoftcenter- 1 comments
- 2 bookmarks
-
Tofu And Baby Corns Stir Fry
chinesetofugarlicky- 1 comments
- 2 bookmarks
-
Easy And Tasty Tofu Stir Fry
asianstirfrytofugarliconionspepperscarrotsgingermus- 2 comments
- 4 bookmarks
-
Quick Turkey Stir-fry
stirfryquickeasylowfatspicygarlicky- 6 comments
- 3 bookmarks
-
Fried Rice With Scallions Edamame And Tofu
friedricesavory- 0 comments
- 1 bookmarks
Narrow your search
Use the filters in this column to find the perfect recipe.
Cuisine Filters
Ingredient Filters
meats
- oysters 7
- chicken 3
- turkey 2
- bacon 1
- beef 1
- pork 3
- chicken breasts 1
- sausage 1
- steak 1
- steaks 1
- View More ↓
- onion 26
- carrots 12
- vegetables 9
- bean sprouts 4
- broccoli 6
- bok choy 3
- cabbage 3
- celery 3
- cornstarch 3
- mushrooms 10
- scallions 3
- snow peas 3
- baby corn 2
- cauliflower 2
- frozen peas 2
- green bell peppers 2
- red bell peppers 2
- baby bok choy 1
- baby carrots 1
- cauliflower florets 1
- corn 1
- cornflour 1
- tomatoes 1
- fresh carrots 1
- frozen green beans 1
- frozen mixed vegetables 1
- frozen peas and carrots 1
- mixed vegetables 1
- mung bean sprouts 1
- shallots 1
- spinach 1
- sugar snap peas 1
- squash 1
- zucchini 1
- View More ↓
- butter 1
- creamy peanut butter 1
- margarine 1
- milk 1
- peanut butter 1
- unsweetened coconut milk 1
- View More ↓
- chili sauce 3
- chilies 3
- cayenne powder 2
- chili paste 2
- sweet chili sauce 2
- chili oil 1
- red chili sauce 1
- red chilies 1
- View More ↓
- oil 17
- firm tofu 14
- tofu 12
- eggs 9
- sugar 9
- oyster sauce 7
- flour 6
- extra firm tofu 6
- cooked rice 5
- beans 4
- noodles 3
- olives 3
- stir-fry sauce 2
- lime juice 2
- silken tofu 2
- roast 2
- limes, juice of 2
- fish sauce 2
- cooked brown rice 2
- honey 2
- cooked white rice 2
- masala 1
- mung beans 1
- pecan halves 1
- pecans 1
- protein powder 1
- radishes 1
- red capsicums 1
- reduced-sodium chicken broth 1
- velveeta cheese 1
- semisweet chocolate 1
- shoyu 1
- string beans 1
- tamari 1
- tea 1
- toast 1
- vegetable stock 1
- water chestnuts 1
- white beans 1
- long grain white rice 1
- sesame seed oil 1
- shiitake mushroom caps 1
- instant rice 1
- cornmeal 1
- crisco 1
- chicken broth 1
- baking powder 1
- bamboo shoots 1
- black bean sauce 1
- black beans 1
- black tea 1
- bread 1
- cake 1
- cooking oil 1
- sliced water chestnuts 1
- edamame 1
- egg noodles 1
- espresso powder 1
- fish 1
- frozen french fries 1
- garam masala powder 1
- hot water 1
- long grain rice 1
- chips 1
- yoghurt 1
- View More ↓
- cloves 17
- garlic 20
- soy sauce 16
- ginger 11
- vegetable oil 7
- canola oil 4
- pepper 16
- dark soy sauce 3
- ground ginger 3
- low sodium soy sauce 3
- minced ginger 3
- olive oil 4
- sesame oil 3
- cilantro 2
- dark sesame oil 2
- hoisin sauce 2
- light soy sauce 2
- salad dressing 2
- seasoning 2
- cajun seasoning 1
- chinese five spice powder 1
- chinese rice wine 1
- cinnamon 1
- coriander 1
- dill 1
- dry sherry 1
- ground cumin 1
- italian seasoning 1
- miracle whip 1
- mirin 1
- oregano 1
- paprika 1
- parsley 1
- reduced sodium soy sauce 1
- rice wine vinegar 1
- salt 1
- sesame seeds 1
- spices 1
- teriyaki sauce 1
- thyme 1
- toasted sesame oil 1
- vanilla 1
- vinegar 1
- white vinegar 1
- white wine 1
- View More ↓









